DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and Tspo

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_033905.3 Gene:Tspo / 12257 MGIID:88222 Length:169 Species:Mus musculus


Alignment Length:150 Identity:69/150 - (46%)
Similarity:95/150 - (63%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVWRDGGGF 79
            |..::|:|||.......|.....|||:|:.||:.||....||:|.:||:.||||||:||::.|||
Mouse    10 GLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGF 74

  Fly    80 AGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFV 144
            . |.|.:||..|..||||||||.|||||...:...|.|::.::..|:|..:.::||:..|..|..
Mouse    75 T-EDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLY 138

  Fly   145 PYVAWLGFATALNYAIWKLN 164
            ||:|||.|||.|||.:|:.|
Mouse   139 PYLAWLAFATVLNYYVWRDN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 66/143 (46%)
TspoNP_033905.3 TspO_MBR 12..155 CDD:281118 66/142 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850066
Domainoid 1 1.000 143 1.000 Domainoid score I4657
eggNOG 1 0.900 - - E1_COG3476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H574
Inparanoid 1 1.050 146 1.000 Inparanoid score I4407
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52353
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 1 1.000 - - oto94522
orthoMCL 1 0.900 - - OOG6_102539
Panther 1 1.100 - - LDO PTHR10057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1562
SonicParanoid 1 1.000 - - X5530
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.