DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and tspo

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001120003.1 Gene:tspo / 100144961 XenbaseID:XB-GENE-5863588 Length:162 Species:Xenopus tropicalis


Alignment Length:155 Identity:79/155 - (50%)
Similarity:110/155 - (70%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVWRDGGGF 79
            |..|||::|||..|.:|||.:::||..|..||::|||.:|.|:|.:||..|||||||::::.||.
 Frog     9 GLTILPHVGGIAGGLITRQEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMGYGSYLIYKELGGL 73

  Fly    80 AGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFV 144
             .|.|.:||..|.:||||||||||||||.|.|..||:|::.|..||:|..:.:|.:::.|..|.:
 Frog    74 -NENAVVPLGLYASQLALNWAWTPIFFGAHKIGWGLVDLLLLWGAAAATTISWYPISRPAAYLML 137

  Fly   145 PYVAWLGFATALNYAIWKLNPEKEQ 169
            ||:|||..|:||||.|||.|.:|.:
 Frog   138 PYLAWLTLASALNYRIWKDNKDKSE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 73/143 (51%)
tspoNP_001120003.1 TspO_MBR 11..154 CDD:281118 73/143 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3839
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H574
Inparanoid 1 1.050 175 1.000 Inparanoid score I3950
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 1 1.000 - - oto104726
Panther 1 1.100 - - LDO PTHR10057
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1562
SonicParanoid 1 1.000 - - X5530
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.