DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and fev

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001315078.1 Gene:fev / 791175 ZFINID:ZDB-GENE-070112-1852 Length:235 Species:Danio rerio


Alignment Length:234 Identity:106/234 - (45%)
Similarity:129/234 - (55%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CAGSRRGGMLLAQHFAISLYHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLL 262
            |.||....|.|:.            .|..:|.:.:...:..:|..    |.:|| ||||||||||
Zfish    18 CGGSLMFNMYLSD------------PTENLLKESKSPSWTPINTG----VQKGS-GQIQLWQFLL 65

  Fly   263 ELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHG 327
            |||:||:|...|:|||.:|||:|||||||||||||||:|||||||||||||||||||||||||||
Zfish    66 ELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHG 130

  Fly   328 KRYAYKFDFHGLMAACQAQAQGGDPASSMLGSYNHHA-------GGAMQL-----GRHP------ 374
            |||||||||:||...||       |:|:....|...:       .|..:|     |..|      
Zfish   131 KRYAYKFDFNGLAQVCQ-------PSSTEQAIYKFQSNFAPIQFSGISKLNLVAPGVGPSGFSYW 188

  Fly   375 ---PPLHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSL 410
               ||..:|..:..|....|.   :...|.|..:|.:||
Zfish   189 PGSPPTLYHSHNLQPPGPFGA---VSASHLSCVNNINSL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 5/18 (28%)
ETS 254..339 CDD:197710 73/84 (87%)
fevNP_001315078.1 ETS 57..142 CDD:197710 73/84 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1113327at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3711
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.