DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Ets98B

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_524535.2 Gene:Ets98B / 43334 FlyBaseID:FBgn0005659 Length:518 Species:Drosophila melanogaster


Alignment Length:419 Identity:96/419 - (22%)
Similarity:138/419 - (32%) Gaps:174/419 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SSYSSTDSD--------------SGSSTSSSSIRSQLPALNLPVPLPLATPTPPAVSSPHQAPSP 130
            |:|.|..|.              .||..|.:|....|.|:::...|.:..|:||  .|..:.|||
  Fly   104 SAYPSPQSSPLQSEFAAYGLGRFGGSYDSLNSPSPSLEAVSIKQELHILPPSPP--ESNCETPSP 166

  Fly   131 RRNSSDS----------------------------------------------------NRSVSP 143
            |.:..:|                                                    ..::.|
  Fly   167 RSSCGESIKAEPLDADIESLIDLNSLLQQQSLQSPQNLQDTKPDHQLLRECLEDTSFQKRHNLKP 231

  Fly   144 --------------------------------------VEVPVDPHAWTPEDIASWVRWATRKFK 170
                                                  :::..||:.|:|..:.:|:|....:|:
  Fly   232 LALESFIGGLAEVRGDFEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFR 296

  Fly   171 LDPEPDID-RFPKDAQELCDLSRADFWVCAGSRR----GGMLLAQ-------------------- 210
            |.|..|:: .|.::...|..||..:|     .||    |..|.||                    
  Fly   297 LPPVADLELHFCENGAALALLSEEEF-----VRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQ 356

  Fly   211 -----HFAISL--------YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQ------------- 249
                 |:..|.        |:....:...|..|.:..|   ||.::....|.             
  Fly   357 SASTDHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAP---LNGSTTSPPATNASNGGTATVKRP 418

  Fly   250 ------GSGGQIQLWQFLLELLADSS-NANAISWEGQS-GEFRLIDPDEVARRWGERKAKPNMNY 306
                  |.|..|.|||||.||||... |..||.|..:| |.|::.|...||:.||.||.:|.|||
  Fly   419 NGGRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNRPAMNY 483

  Fly   307 DKLSRALRYYYDKNIMTKV-HGKRYAYKF 334
            |||||::|.||.|.||.|. ..:|..|:|
  Fly   484 DKLSRSIRQYYKKGIMKKTERSQRLVYQF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 23/105 (22%)
ETS 254..339 CDD:197710 43/84 (51%)
Ets98BNP_524535.2 SAM_PNT-PDEF-like 264..345 CDD:188878 21/85 (25%)
ETS 429..517 CDD:197710 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.