DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Etv2

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_038949886.1 Gene:Etv2 / 361544 RGDID:1310603 Length:368 Species:Rattus norvegicus


Alignment Length:281 Identity:93/281 - (33%)
Similarity:125/281 - (44%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SDSGSSTSSS-SIRSQLPALNLPVPLPLATPTPPAVSSPHQAPSP---RRNSSDSNRSVSPVEVP 147
            :|.|.:||.. |..||.|.           |.||..|     |||   ...::..|.:.|...||
  Rat   119 TDLGCNTSDPWSCASQTPG-----------PAPPGTS-----PSPFVGFEGATGQNTATSAGGVP 167

  Fly   148 VDPHAWTPEDIASW----VRWATRKFKLDPEPDIDRFPKDAQELCDLSRADFWVCAGSRRG---- 204
                        ||    ..|:|..:.....|:...:....  |...::||:.:..|...|    
  Rat   168 ------------SWSHPPATWSTASWDCSAGPNGSTYWDSG--LGGEAQADYKMSWGGSAGSDYT 218

  Fly   205 -----GMLLAQHFAISL------YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLW 258
                 |:   |:.:|..      ..||..::|...:.....||...|   ||       |.||||
  Rat   219 TTWNSGL---QNCSIPFEGHQIPAFATPSKSSQQSDRATLTPYSKTN---HR-------GPIQLW 270

  Fly   259 QFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMT 323
            |||||||.|.:.::.|.|.|.:.||:|.||.||||.|||||.||.|||:||||.|||||.::|:.
  Rat   271 QFLLELLHDGARSSCIRWTGNNREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVL 335

  Fly   324 KVHGKRYAYKFDFHGLMAACQ 344
            |..|::|.|:|.....:.|||
  Rat   336 KSGGRKYTYRFGGRVPVLACQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 13/86 (15%)
ETS 254..339 CDD:197710 49/84 (58%)
Etv2XP_038949886.1 ETS 266..348 CDD:197710 49/81 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.