DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Elk1

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001101529.1 Gene:Elk1 / 314436 RGDID:1598663 Length:427 Species:Rattus norvegicus


Alignment Length:216 Identity:78/216 - (36%)
Similarity:105/216 - (48%) Gaps:30/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IQLWQFLLELLADSSNANAISWEGQ-SGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYD 318
            :.||||||:||.:..|.:.|||..: .|||:|:|.:||||.||.||.|.||||||||||||||||
  Rat     5 VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYD 69

  Fly   319 KNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDP------ASSMLGSYNHHAGGAMQLGRHPPP- 376
            |||:.||.|:::.|||..:..:|.|..:.....|      |.:|..:..|...|....|:...| 
  Rat    70 KNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATGKPGTPK 134

  Fly   377 ---------LHHHPQHSHPHHQL----------GQPHFLHPHHSSPASNSSSLGFPSSSTASSQA 422
                     |....::.:....|          .||. |||..:|...|::..|.|:..:.|...
  Rat   135 GAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPP-LHPRPASVLPNTTPAGVPAPPSGSRST 198

  Fly   423 SPGQAPASSSASTSNFTAPFQ 443
            ||....|...|..:..  |.|
  Rat   199 SPNPLEACLEAEEAGL--PLQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 51/84 (61%)
Elk1NP_001101529.1 ETS 4..89 CDD:197710 51/83 (61%)
PHA03247 <100..427 CDD:223021 25/121 (21%)
PHA03132 112..>246 CDD:222997 23/109 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..202 12/36 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..350
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 348..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.