Sequence 1: | NP_001285547.1 | Gene: | Ets21C / 33229 | FlyBaseID: | FBgn0005660 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571005.2 | Gene: | elk4 / 30093 | ZFINID: | ZDB-GENE-030716-1 | Length: | 443 | Species: | Danio rerio |
Alignment Length: | 278 | Identity: | 85/278 - (30%) |
---|---|---|---|
Similarity: | 112/278 - (40%) | Gaps: | 101/278 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 IQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDK 319
Fly 320 NIMTKVHGKRYAYKFDFHG--LMAACQAQAQGGDP------------------------------ 352
Fly 353 --ASSMLGSYNH--HAG-------GAMQLGRH-----------------------PPPLH----- 378
Fly 379 -HHPQHSHPHHQLGQPHFLHPHHSSP----------------------ASNSSSLGFPSSSTA-- 418
Fly 419 ----SSQASPGQAPASSS 432 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets21C | NP_001285547.1 | SAM_PNT | 149..217 | CDD:188876 | |
ETS | 254..339 | CDD:197710 | 49/85 (58%) | ||
elk4 | NP_571005.2 | ETS | 17..89 | CDD:197710 | 41/71 (58%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |