DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Fev

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_694751.1 Gene:Fev / 260298 MGIID:2449712 Length:237 Species:Mus musculus


Alignment Length:228 Identity:101/228 - (44%)
Similarity:115/228 - (50%) Gaps:77/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSR 311
            |.:|| |||||||||||||||.:||..|:|||..|||:|.|||||||||||||:|||||||||||
Mouse    40 VQKGS-GQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 103

  Fly   312 ALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDPASSMLGSYNHHAGGAMQLGRHPPP 376
            |||||||||||:|||||||||:|||.||..|||                             |||
Mouse   104 ALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQ-----------------------------PPP 139

  Fly   377 LHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASSQASPGQAPASSSASTSNFTAP 441
            .|.|                                 :::.|::.|:..|..|...........|
Mouse   140 AHAH---------------------------------AAAAAAAAAAAAQDGALYKLPAGLAPLP 171

  Fly   442 FQG--------GTAGVDPARTSTSSAGNYDQGP 466
            |.|        .:|||.||..|      |..||
Mouse   172 FPGLSKLNLMAASAGVAPAGFS------YWPGP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 71/84 (85%)
FevNP_694751.1 ETS 46..131 CDD:197710 71/84 (85%)
May mediate active transcriptional repression. /evidence=ECO:0000250 129..237 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3711
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.