Sequence 1: | NP_001285547.1 | Gene: | Ets21C / 33229 | FlyBaseID: | FBgn0005660 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001357733.1 | Gene: | Erfl / 232974 | MGIID: | 3642958 | Length: | 352 | Species: | Mus musculus |
Alignment Length: | 320 | Identity: | 99/320 - (30%) |
---|---|---|---|
Similarity: | 127/320 - (39%) | Gaps: | 115/320 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 QIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYD 318
Fly 319 KNIMTKVHGKRYAYKFDFHGLMAA------CQAQAQG---------------------------- 349
Fly 350 -------GDPAS--------------------------------SMLGSYNHHAGGAMQLGRHPP 375
Fly 376 --PLHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASS--QASP---------GQA 427
Fly 428 PASSSASTSNFTAPFQGG----TAG----------VDPARTSTSSAGNYDQGPVTPTTNA 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets21C | NP_001285547.1 | SAM_PNT | 149..217 | CDD:188876 | |
ETS | 254..339 | CDD:197710 | 53/84 (63%) | ||
Erfl | NP_001357733.1 | ETS | 41..123 | CDD:197710 | 52/81 (64%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |