DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and ETS2

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001243224.1 Gene:ETS2 / 2114 HGNCID:3489 Length:609 Species:Homo sapiens


Alignment Length:440 Identity:114/440 - (25%)
Similarity:153/440 - (34%) Gaps:183/440 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ASSYSST-DSDSGSSTSSSSIRSQLPALN-----LPVP--------------LPLATPTPPAVSS 123
            |:||..| .......|...|:.:..|:||     ..||              |||.||...||.|
Human   156 ANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMS 220

  Fly   124 PHQAPSPRRNSSDSNRSVSPVEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELC 188
                .:.:...|...:....:.:|.:|..|:.:.:..|:.|||.:|.| ...::.||..:.|.||
Human   221 ----QALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSL-VNVNLQRFGMNGQMLC 280

  Fly   189 DLSRADF------------------------------------------WVCAGS---------- 201
            :|.:..|                                          |:.:.:          
Human   281 NLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPY 345

  Fly   202 -------RRGGML-----------------------------------LAQHF-AISLYHATGRE 223
                   .:||:|                                   ::|.| ..:|...|...
Human   346 GMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNS 410

  Fly   224 TSPMLNDDEPNP----------YQLLNAASHRL-------------------------------- 246
            .:|..:|...|.          .|..|:.|..|                                
Human   411 GTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYI 475

  Fly   247 ------VAQG-------------SGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVA 292
                  |.||             ..|.|||||||||||:|.|..:.|||.|...||:|.||||||
Human   476 QERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA 540

  Fly   293 RRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFHGLM 340
            ||||:||.||.|||:||||.|||||||||:.|..||||.|:|  |...|:
Human   541 RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 21/162 (13%)
ETS 254..339 CDD:197710 58/86 (67%)
ETS2NP_001243224.1 GSK-3_bind <39..>143 CDD:283100
SAM_PNT-ETS-2 225..313 CDD:188884 17/88 (19%)
ETS 502..586 CDD:197710 57/83 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.