Sequence 1: | NP_001285547.1 | Gene: | Ets21C / 33229 | FlyBaseID: | FBgn0005660 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359862.1 | Gene: | ets-4 / 180927 | WormBaseID: | WBGene00017687 | Length: | 463 | Species: | Caenorhabditis elegans |
Alignment Length: | 443 | Identity: | 90/443 - (20%) |
---|---|---|---|
Similarity: | 137/443 - (30%) | Gaps: | 203/443 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 SYSSTDSDSGS-----------------STSSSS-IRSQLP----------ALNL---PVPLPLA 114
Fly 115 TPTPPAVSSPHQAPSPRRNSSDSNRS---------------VSP--------------------- 143
Fly 144 -------------VEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQ----ELCDLS 191
Fly 192 RADFWV---CAGSRRGGMLLAQHFAISLYH-------------------------ATGRETSPML 228
Fly 229 NDDEPN-PY-----------------------------QLLNAASHRL----------------- 246
Fly 247 ---------------VAQGSGGQ------------IQLWQFLLELLADSSNANA-ISW-EGQSGE 282
Fly 283 FRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGK-RYAYKF 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets21C | NP_001285547.1 | SAM_PNT | 149..217 | CDD:188876 | 16/74 (22%) |
ETS | 254..339 | CDD:197710 | 37/96 (39%) | ||
ets-4 | NP_001359862.1 | SAM_PNT-PDEF-like | 158..236 | CDD:188878 | 17/84 (20%) |
ETS | 374..462 | CDD:197710 | 37/84 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |