DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and ets-5

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001263956.1 Gene:ets-5 / 180778 WormBaseID:WBGene00016600 Length:246 Species:Caenorhabditis elegans


Alignment Length:199 Identity:99/199 - (49%)
Similarity:123/199 - (61%) Gaps:30/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLS 310
            |.|.|: |||||||||||||||:.||:.|:|||.:|||:|:|||||||:|||||:||||||||||
 Worm    65 LSATGT-GQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLS 128

  Fly   311 RALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQ--AQGGDP---ASSMLGSYNHHAGGAMQL 370
            |||||||||||||||.||||||||||.||..|||:.  ..||:|   .||.:.|.:.:....:.:
 Worm   129 RALRYYYDKNIMTKVQGKRYAYKFDFQGLAQACQSAILTNGGNPNGDLSSTVHSLSPYTNQVLPI 193

  Fly   371 GRHPPPLHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASSQASPGQAPASSSAST 435
            |                        :....|:..|:..|:...:|||:|:|..|.......|...
 Worm   194 G------------------------VTSRLSTSMSSYHSILSSTSSTSSNQIIPPSTATYWSTPQ 234

  Fly   436 SNFT 439
            |:.|
 Worm   235 SSLT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 71/84 (85%)
ets-5NP_001263956.1 ETS 72..157 CDD:197710 71/84 (85%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3711
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.930

Return to query results.
Submit another query.