DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and ets-9

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001371009.1 Gene:ets-9 / 180702 WormBaseID:WBGene00016865 Length:225 Species:Caenorhabditis elegans


Alignment Length:189 Identity:51/189 - (26%)
Similarity:75/189 - (39%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PDIDRFPKDAQELCDLSR-----------ADFWV-----CAGSRRGGMLLAQHFAISLYHATGRE 223
            |::..|..|.:...|:|.           |.|.:     ||         ...|..||:      
 Worm    14 PNLGNFTHDVRTYPDISPPTPTNSHIRCWAQFSIAQQLPCA---------VPSFPTSLF------ 63

  Fly   224 TSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDP 288
            ..|::||:.....:|:...          |..:|..||:.|..:.....|:.|.|...||.|::.
 Worm    64 PLPIMNDEPMTDDELVKMK----------GPSRLIGFLVHLAMNERARKALRWTGNGLEFVLVNK 118

  Fly   289 DEVARRWGERKAK-PNMNYDKLSRALRYYY------DKNI---MTKVHGKRYAYKFDFH 337
            :.||:.||.||.. .:|:|.|||||:|..|      ||||   ..|...:.|:|.|..|
 Worm   119 ELVAKMWGNRKHNTKDMDYYKLSRAIREKYEKKDKADKNIKPGKLKKGTRTYSYVFTEH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 11/57 (19%)
ETS 254..339 CDD:197710 34/94 (36%)
ets-9NP_001371009.1 Ets 86..>150 CDD:413392 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.