DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Erf

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_030097988.1 Gene:Erf / 13875 MGIID:109637 Length:552 Species:Mus musculus


Alignment Length:187 Identity:78/187 - (41%)
Similarity:93/187 - (49%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 QIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYD 318
            |||||.|:||||........|:|:|..|||.:.|||||||.||.||.||.||||||||||||||:
Mouse    27 QIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRYYYN 91

  Fly   319 KNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDPASSMLGSYNHHAGGAMQLGRHPPPLHHHPQH 383
            |.|:.|..|||:.|||:|:.|:.........|            .||||:.....|.|       
Mouse    92 KRILHKTKGKRFTYKFNFNKLVLVNYPFIDMG------------LAGGAVPQSAPPVP------- 137

  Fly   384 SHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASSQASPGQAPASSSASTSNFTA 440
                  .|..||..| .|:|           |...|....|...||.||:|:|.|:|
Mouse   138 ------SGGSHFRFP-PSTP-----------SEVLSPTEDPRSPPACSSSSSSLFSA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 53/84 (63%)
ErfXP_030097988.1 ETS 27..112 CDD:197710 53/84 (63%)
PHA03247 <127..384 CDD:223021 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.