DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and Elk3

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_038536.2 Gene:Elk3 / 13713 MGIID:101762 Length:409 Species:Mus musculus


Alignment Length:243 Identity:78/243 - (32%)
Similarity:109/243 - (44%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDK 319
            |.||||||.||.|..:.:.|.|....|||:|:..:|||:.||.||.|.|||||||||||||||||
Mouse     5 ITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDK 69

  Fly   320 NIMTKVHGKRYAYKF---------DFHGLMAACQA-QAQGGDPASSMLGSYNH-HAGGAMQLGRH 373
            ||:.||.|:::.|||         |.|.:..:.:: ..|.||...|..|...| |...:::....
Mouse    70 NIIKKVIGQKFVYKFVSFPDILKMDPHAVEISRESLLLQDGDCKVSPEGREVHRHGLSSLKSASR 134

  Fly   374 PPPLHHHPQHSHPHHQL-GQPHFL---------HPHHSSP-----------ASNSSS-------L 410
            ...||.....|...:.| ..|...         .|...||           .:|.:.       :
Mouse   135 NEYLHSGLYSSFTINSLQNAPEAFKAIKTEKLEEPCDDSPPVEEVRTVIRFVTNKTDKHITRPVV 199

  Fly   411 GFPSSSTASSQASPGQAPASSSASTSNFTAPFQGGTAGVDPARTSTSS 458
            ..||:|..::.|:.....:|.||..|:...|.....:...|:.:.:.|
Mouse   200 SLPSTSETAAAAASAFLASSVSAKISSLMLPNAASISSASPSSSRSPS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 51/92 (55%)
Elk3NP_038536.2 ETS 5..89 CDD:197710 49/83 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..255 2/13 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..298
CTBP-binding motif 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.