Sequence 1: | NP_001285547.1 | Gene: | Ets21C / 33229 | FlyBaseID: | FBgn0005660 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038536.2 | Gene: | Elk3 / 13713 | MGIID: | 101762 | Length: | 409 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 78/243 - (32%) |
---|---|---|---|
Similarity: | 109/243 - (44%) | Gaps: | 39/243 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 IQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDK 319
Fly 320 NIMTKVHGKRYAYKF---------DFHGLMAACQA-QAQGGDPASSMLGSYNH-HAGGAMQLGRH 373
Fly 374 PPPLHHHPQHSHPHHQL-GQPHFL---------HPHHSSP-----------ASNSSS-------L 410
Fly 411 GFPSSSTASSQASPGQAPASSSASTSNFTAPFQGGTAGVDPARTSTSS 458 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets21C | NP_001285547.1 | SAM_PNT | 149..217 | CDD:188876 | |
ETS | 254..339 | CDD:197710 | 51/92 (55%) | ||
Elk3 | NP_038536.2 | ETS | 5..89 | CDD:197710 | 49/83 (59%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 235..255 | 2/13 (15%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 273..298 | ||||
CTBP-binding motif | 275..279 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |