Sequence 1: | NP_001285547.1 | Gene: | Ets21C / 33229 | FlyBaseID: | FBgn0005660 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031948.4 | Gene: | Elk1 / 13712 | MGIID: | 101833 | Length: | 429 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 77/228 - (33%) |
---|---|---|---|
Similarity: | 102/228 - (44%) | Gaps: | 52/228 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 IQLWQFLLELLADSSNANAISWEGQ-SGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYD 318
Fly 319 KNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDPASSM-----LGSYNHHAG-GAMQLGRHPPP- 376
Fly 377 -------------------------------LHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSL 410
Fly 411 GFPSSSTASSQASPGQAPASSSASTSNFTAPFQ 443 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets21C | NP_001285547.1 | SAM_PNT | 149..217 | CDD:188876 | |
ETS | 254..339 | CDD:197710 | 51/84 (61%) | ||
Elk1 | NP_031948.4 | ETS | 4..89 | CDD:197710 | 51/83 (61%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 119..146 | 6/26 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..204 | 12/49 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 227..253 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 302..354 | ||||
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 | 350..400 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |