DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and LOC100537796

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_009297062.2 Gene:LOC100537796 / 100537796 -ID:- Length:269 Species:Danio rerio


Alignment Length:233 Identity:81/233 - (34%)
Similarity:101/233 - (43%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 QIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYD 318
            |:|||.||||||. .....||:|..:.|||.:.||:.:|:.|||||.||:||||||||||||||:
Zfish    38 QVQLWHFLLELLG-RGEGGAITWGSEWGEFVIRDPERLAKLWGERKGKPHMNYDKLSRALRYYYN 101

  Fly   319 KNIMTKVHGKRYAYKFDFHGL-------MAACQAQAQGGDPAS---SMLGSYNHHAGGA-MQLGR 372
            |.|:.|..|||:.|:|:|..|       :..| .|.....|.|   |.|..||.....| ||...
Zfish   102 KRILHKTKGKRFTYRFNFSKLILVNYPSLPTC-PQNTPSAPFSVFPSQLSFYNSSIDRASMQSIS 165

  Fly   373 HPPPLHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASSQAS--PGQAPASSSAST 435
            ||..|                         |.|....|.||.......|..  ||..|:..:.|.
Zfish   166 HPLLL-------------------------PYSFPKPLPFPQVHPIQRQIPFFPGPPPSGINLSE 205

  Fly   436 SNFTAPFQGGTAGVDPARTSTSSAGNYDQGPVTPTTNA 473
            .:..:|              .|||..:.|....|..|:
Zfish   206 LSSLSP--------------VSSALQFSQSLNWPVKNS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 49/84 (58%)
LOC100537796XP_009297062.2 ETS 38..122 CDD:197710 49/84 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.