DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and elk4

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_002933036.1 Gene:elk4 / 100491321 XenbaseID:XB-GENE-490642 Length:408 Species:Xenopus tropicalis


Alignment Length:80 Identity:48/80 - (60%)
Similarity:60/80 - (75%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDK 319
            |.||||||:||.:..:...|.|....|||:|:..:||||.||.||.||:||||||||||||||.|
 Frog     5 ITLWQFLLQLLQEPHHNQLICWTSNDGEFKLLQAEEVARLWGVRKNKPSMNYDKLSRALRYYYVK 69

  Fly   320 NIMTKVHGKRYAYKF 334
            ||:.||:|:::.|||
 Frog    70 NIIKKVNGQKFVYKF 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 48/80 (60%)
elk4XP_002933036.1 ETS 17..89 CDD:197710 39/68 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.