DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets21C and fev

DIOPT Version :9

Sequence 1:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_002934005.1 Gene:fev / 100485880 XenbaseID:XB-GENE-853582 Length:219 Species:Xenopus tropicalis


Alignment Length:180 Identity:101/180 - (56%)
Similarity:113/180 - (62%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSR 311
            |.:|| |||||||||||||:|.:|||.|:|||.:|||:|.|||||||||||||:|||||||||||
 Frog    39 VQKGS-GQIQLWQFLLELLSDHANANCIAWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSR 102

  Fly   312 ALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQA---------QAQGGDP--ASSMLGSYNHHAG 365
            |||||||||||.||||||||||||||||...||:         :.||..|  ..|.|...|    
 Frog   103 ALRYYYDKNIMAKVHGKRYAYKFDFHGLAQVCQSAPTTEQGLYKFQGNLPHLPFSGLSKLN---- 163

  Fly   366 GAMQLGRHPPPLHHHPQHSHPHHQLGQPHFLHPHH--SSPASNSSSLGFP 413
             .|..|..|....:.|         |.|..|:|.|  .||....||:..|
 Frog   164 -LMTSGVSPAGFSYWP---------GTPSALYPSHGLQSPPGGFSSVSAP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 73/84 (87%)
fevXP_002934005.1 ETS 45..130 CDD:197710 73/84 (87%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1113327at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.