DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spp and SPPL2A

DIOPT Version :9

Sequence 1:NP_523444.1 Gene:Spp / 33227 FlyBaseID:FBgn0031260 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_005254779.1 Gene:SPPL2A / 84888 HGNCID:30227 Length:538 Species:Homo sapiens


Alignment Length:390 Identity:108/390 - (27%)
Similarity:180/390 - (46%) Gaps:84/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSTPEGMAVAYSSLV--VMAMLPIIFGSIRS--VKLHKLKKSTGEKADTMTKKD---------AM 85
            ||.|.   ..|:.:|  |:|:..:..|...|  |:|..||..|.|..:...||:         .:
Human   163 PSWPN---FDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVV 224

  Fly    86 YFPLIASAALFGLYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSLMPAAVPKVPFHIL 150
            .|.:|....:..||.|:|     .:.|::...|.:...::|.:.|:.:|:        |:|:...
Human   225 IFVVICCVMMVLLYFFYK-----WLVYVMIAIFCIASAMSLYNCLAALIH--------KIPYGQC 276

  Fly   151 FTKGEGKHKEDIVNYKFSTHDIVCLVISSAIGVWYLLKKH----WIANNLFGLAFAINGVEMLHL 211
            .....||:.|  |...|.:.  :|:.::.   ||.:.:..    ||..::.|:||.:|.::.|.|
Human   277 TIACRGKNME--VRLIFLSG--LCIAVAV---VWAVFRNEDRWAWILQDILGIAFCLNLIKTLKL 334

  Fly   212 NNFVTGVILLSGLFFYDIFWVF--------GTNVMVTVAKS------------FEA--------- 247
            .||.:.||||..|..||:|:||        |.::||.:|..            .||         
Human   335 PNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKNDGNLVEATGQPSAPHE 399

  Fly   248 --PIKLVFPQDLIENGLNA--SNFAMLGLGDIVIPGIFIALLLRFDDSKKRKTRIYFYSTLIAYF 308
              |:.:..|:.:..:.::.  ...::||.|||::||:.||...|| |.:...:.||:.|:.:||.
Human   400 KLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRF-DVQTGSSYIYYVSSTVAYA 463

  Fly   309 LGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIRGELKVLF---AYE--DH-----PEEKP 363
            :|::.|..|:.:.|..|||||||||..:.|..:||..|.|:|..:   :|:  ||     .||.|
Human   464 IGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENP 528

  Fly   364  363
            Human   529  528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppNP_523444.1 Peptidase_A22B 71..358 CDD:282158 90/337 (27%)
SPPL2AXP_005254779.1 PA_hSPPL_like 41..160 CDD:239044
Peptidase_A22B 210..514 CDD:282158 87/324 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.