DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spp and Sppl3

DIOPT Version :9

Sequence 1:NP_523444.1 Gene:Spp / 33227 FlyBaseID:FBgn0031260 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_083288.2 Gene:Sppl3 / 74585 MGIID:1891433 Length:384 Species:Mus musculus


Alignment Length:399 Identity:114/399 - (28%)
Similarity:174/399 - (43%) Gaps:103/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AYS-------SLVVMAMLPIIFGSIRSVKL-----HKLK-----------KSTGEKADTMTKKDA 84
            |||       |..::::|.|::||.||:.:     .|.|           .||.....|:....|
Mouse     9 AYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGNSTNNSIQTIDSTQA 73

  Fly    85 MYFPLIASAALFGLYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSLMPAAVP--KVPF 147
            ::.|:.||.:|..::.||...|.|     .|....||..||.|.||.|:...|.....|  |:.|
Mouse    74 LFLPIGASVSLLVMFFFFDSVQVV-----FTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISF 133

  Fly   148 HIL--FTKGEGKHKEDIVNYKFSTHDIVCLVISSAIGVWYLLKKHWIANNLFGLAFAINGVEMLH 210
            ...  ||..|      ::::..|    |.||:     :| :|..||:..:...:...:..:..:.
Mouse   134 GCCGRFTAAE------LLSFSLS----VMLVL-----IW-VLTGHWLLMDALAMGLCVAMIAFVR 182

  Fly   211 LNNFVTGVILLSGLFFYDIFWV------FGTNVMVTVAKS------------------------- 244
            |.:.....:|||||..||:|||      |.:||||.||..                         
Mouse   183 LPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPR 247

  Fly   245 FEAPIKLVFPQDLIENGLNASNFAMLGLGDIVIPGIFIALLLRFDDSKK---------------- 293
            ...|.|||||..      ..|:|:|||:||||:||:.:..:||:|:.||                
Mouse   248 LSLPGKLVFPSS------TGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANIS 306

  Fly   294 -RKTRI-YFYSTLIAYFLGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIRGELKVLFAYE 356
             |..:: ||:.|||.||:|||.......:.:.||||||||||..:...|.:|.::|:|:.:::..
Mouse   307 GRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEP 371

  Fly   357 DHPEEKPEK 365
            .|.:....:
Mouse   372 FHSKSSSSR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppNP_523444.1 Peptidase_A22B 71..358 CDD:282158 101/339 (30%)
Sppl3NP_083288.2 Peptidase_A22B 61..374 CDD:282158 100/339 (29%)
PAL 341..343 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52034
OrthoDB 1 1.010 - - D1087991at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1942
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.