DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spp and Sppl2a

DIOPT Version :9

Sequence 1:NP_523444.1 Gene:Spp / 33227 FlyBaseID:FBgn0031260 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006234982.1 Gene:Sppl2a / 311401 RGDID:1563001 Length:541 Species:Rattus norvegicus


Alignment Length:403 Identity:110/403 - (27%)
Similarity:178/403 - (44%) Gaps:98/403 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSTPEGMAVAYSSLV--VMAMLPIIFGSIRS--VKLHKLKK-STGEKADTMTKKD---------A 84
            ||.|.   ..|:.:|  |:|:..:..|...|  ::|..:|. ...|..:...||:         .
  Rat   166 PSWPN---FDYTLVVIFVIAVFTVALGGYWSGLIELESMKAVEDAEDREARKKKEDYLTFSPLTV 227

  Fly    85 MYFPLIASAALFGLYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSLMPAAVPKVPFHI 149
            :.|.:|....:..||.|:|     .:.|::...|.:....:|.:.|:.:|:. ||.         
  Rat   228 VLFVVICCVMIVLLYFFYK-----WLVYVMIAIFCIASATSLYNCLAALIHR-MPC--------- 277

  Fly   150 LFTKGE------GKHKEDIVNYKFSTHDIVCLVISSAIGVWYLLKKH----WIANNLFGLAFAIN 204
                |:      ||      |.|.|...:..|.||.|: ||.:.:..    ||..::.|:||.:|
  Rat   278 ----GQCTILCCGK------NIKVSLIFLSGLCISVAV-VWAVFRNEDRWAWILQDILGIAFCLN 331

  Fly   205 GVEMLHLNNFVTGVILLSGLFFYDIFWVF--------GTNVMVTVAKS-FE-------------- 246
            .::.:.|.||::.||||..|..||:|:||        |.::||.:|.. ||              
  Rat   332 LIKTMKLPNFMSCVILLGLLLIYDVFFVFITPFITKNGESIMVELAAGPFENAEKNDGNFVEATA 396

  Fly   247 --------APIKLVFPQ--DLIENGLNASNFAMLGLGDIVIPGIFIALLLRFDDSKKRKTRIYFY 301
                    .|:.:..|:  |.....:.:...::||.|||::||:.||...|||  .:..:.||:.
  Rat   397 LHSAPHEKLPVVIRVPKLMDYSVMSVCSVPVSVLGFGDIIVPGLLIAYCRRFD--VQTGSSIYYI 459

  Fly   302 STLIAYFLGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIRGELKVLFA--------YEDH 358
            |:.|||.:|::.|..|:.|.|..|||||||||..:.|..:||..|.|:|..:.        |.|:
  Rat   460 SSTIAYAVGMIITFVVLMVMKTGQPALLYLVPCTLITASIVAWSRKEMKKFWKGSSYQVMDYLDY 524

  Fly   359 P--EEKPEKKEKK 369
            .  ||.|...:::
  Rat   525 STNEENPAATDEQ 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppNP_523444.1 Peptidase_A22B 71..358 CDD:282158 95/346 (27%)
Sppl2aXP_006234982.1 Peptidases_S8_S53 44..163 CDD:299169
Peptidase_A22B 214..517 CDD:282158 93/330 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.