DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spp and Sppl2c

DIOPT Version :9

Sequence 1:NP_523444.1 Gene:Spp / 33227 FlyBaseID:FBgn0031260 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001099317.1 Gene:Sppl2c / 287753 RGDID:1560562 Length:691 Species:Rattus norvegicus


Alignment Length:285 Identity:74/285 - (25%)
Similarity:126/285 - (44%) Gaps:57/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSL--------MPAAVPKVPFHILFTKG 154
            ||.|:..|.     |::.|.|.:.....|...|:|::..|        :|.....|...:|...|
  Rat   275 LYFFYDCFV-----YIMIGIFGLGASTGLYSCLAPIVRYLPLWQHQWVLPGHRASVKLSLLLLAG 334

  Fly   155 EGKHKEDIVNYKFSTHDIVCLVISSAIGVWYLLKKH----WIANNLFGLAFAINGVEMLHLNNFV 215
                              :|.:::.   :|.:.:..    |:..:..|:|:.:..:..:.|....
  Rat   335 ------------------LCAMVTV---LWVIYRNEDRWAWLLQDTLGVAYCLFVLRRVRLPTLK 378

  Fly   216 TGVILLSGLFFYDIFWVF--------GTNVMVTVA------KSFE-APIKLVFPQDLIENGLNAS 265
            .....|..|..:|:|:||        |.::||.||      .|.| .|:.|..|: :..:.|...
  Rat   379 NCTSFLLALLAFDVFFVFITPLFTKTGESIMVEVASGPVDSSSHERLPMVLKVPR-MSFSALTLC 442

  Fly   266 N--FAMLGLGDIVIPGIFIALLLRFDDSKKRKTRIYFYSTLIAYFLGLLATIFVMHVFKHAQPAL 328
            :  |::||.||||:||..:|...|| |.:.:..::|:.:..:||.:|||.|...|.:.:..||||
  Rat   443 DQPFSILGFGDIVVPGFLVAYCHRF-DVQIQSRQVYYRACTVAYAMGLLVTFVAMVLMQMGQPAL 506

  Fly   329 LYLVPACMGTPLLVALIRGELKVLF 353
            ||||.:.:.|.|:||..|.||.:.:
  Rat   507 LYLVSSTLLTSLVVATCRQELTLFW 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppNP_523444.1 Peptidase_A22B 71..358 CDD:282158 74/285 (26%)
Sppl2cNP_001099317.1 Peptidases_S8_S53 40..177 CDD:299169
Peptidase_A22B 250..534 CDD:294809 74/285 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.