DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spp and SPPL3

DIOPT Version :9

Sequence 1:NP_523444.1 Gene:Spp / 33227 FlyBaseID:FBgn0031260 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_620584.2 Gene:SPPL3 / 121665 HGNCID:30424 Length:384 Species:Homo sapiens


Alignment Length:399 Identity:114/399 - (28%)
Similarity:174/399 - (43%) Gaps:103/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AYS-------SLVVMAMLPIIFGSIRSVKL-----HKLK-----------KSTGEKADTMTKKDA 84
            |||       |..::::|.|::||.||:.:     .|.|           .||.....|:....|
Human     9 AYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGNSTNNSIQTIDSTQA 73

  Fly    85 MYFPLIASAALFGLYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSLMPAAVP--KVPF 147
            ::.|:.||.:|..::.||...|.|     .|....||..||.|.||.|:...|.....|  |:.|
Human    74 LFLPIGASVSLLVMFFFFDSVQVV-----FTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISF 133

  Fly   148 HIL--FTKGEGKHKEDIVNYKFSTHDIVCLVISSAIGVWYLLKKHWIANNLFGLAFAINGVEMLH 210
            ...  ||..|      ::::..|    |.||:     :| :|..||:..:...:...:..:..:.
Human   134 GCCGRFTAAE------LLSFSLS----VMLVL-----IW-VLTGHWLLMDALAMGLCVAMIAFVR 182

  Fly   211 LNNFVTGVILLSGLFFYDIFWV------FGTNVMVTVAKS------------------------- 244
            |.:.....:|||||..||:|||      |.:||||.||..                         
Human   183 LPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPR 247

  Fly   245 FEAPIKLVFPQDLIENGLNASNFAMLGLGDIVIPGIFIALLLRFDDSKK---------------- 293
            ...|.|||||..      ..|:|:|||:||||:||:.:..:||:|:.||                
Human   248 LSLPGKLVFPSS------TGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANIS 306

  Fly   294 -RKTRI-YFYSTLIAYFLGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIRGELKVLFAYE 356
             |..:: ||:.|||.||:|||.......:.:.||||||||||..:...|.:|.::|:|:.:::..
Human   307 GRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEP 371

  Fly   357 DHPEEKPEK 365
            .|.:....:
Human   372 FHSKSSSSR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppNP_523444.1 Peptidase_A22B 71..358 CDD:282158 101/339 (30%)
SPPL3NP_620584.2 Peptidase_A22B 61..374 CDD:282158 100/339 (29%)
PAL 341..343 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52034
OrthoDB 1 1.010 - - D1087991at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1942
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.