DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and UBC9

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_010219.1 Gene:UBC9 / 851495 SGDID:S000002222 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:84/153 - (54%)
Similarity:115/153 - (75%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            ||.:.:.||.||||.|||||||||.|:|.|..||:::|..||..||||:.|.|.||:|.:.:.:.
Yeast     1 MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYP 65

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ::||:.|||.||....:|||||||||:|||:|:|::|||||||:|||:||:||||:.||...|||
Yeast    66 NEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

  Fly   131 AEAYTIYCQNRLEYEKRVRAQAR 153
            ..|:..:.:|:.||:|:|..||:
Yeast   131 EPAWRSFSRNKAEYDKKVLLQAK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 80/143 (56%)
UBC9NP_010219.1 COG5078 1..157 CDD:227410 84/153 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346579
Domainoid 1 1.000 190 1.000 Domainoid score I642
eggNOG 1 0.900 - - E2759_KOG0424
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5574
Inparanoid 1 1.050 197 1.000 Inparanoid score I875
Isobase 1 0.950 - 0 Normalized mean entropy S120
OMA 1 1.010 - - QHG53499
OrthoFinder 1 1.000 - - FOG0002579
OrthoInspector 1 1.000 - - oto99099
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2323
SonicParanoid 1 1.000 - - X1694
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.