DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and SCE1

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_191346.1 Gene:SCE1 / 824956 AraportID:AT3G57870 Length:160 Species:Arabidopsis thaliana


Alignment Length:156 Identity:97/156 - (62%)
Similarity:120/156 - (76%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKD 66
            ||||..||.||||:|||:||.||||:|....|||:|||:|.|.||||..|.||||.:.|.|.|.:
plant     3 SGIARGRLAEERKSWRKNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSE 67

  Fly    67 DYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQA 131
            |||:.||||||....||||||||||||||:|:|:..||||||:||||:||||||:.||..||||.
plant    68 DYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLDTPNPADPAQT 132

  Fly   132 EAYTIYCQNRLEYEKRVRAQARAMAA 157
            :.|.::||:.:||:|||:.|::...|
plant   133 DGYHLFCQDPVEYKKRVKLQSKQYPA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 91/143 (64%)
SCE1NP_191346.1 UQ_con 9..152 CDD:395127 91/142 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 212 1.000 Domainoid score I786
eggNOG 1 0.900 - - E2759_KOG0424
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5574
Inparanoid 1 1.050 219 1.000 Inparanoid score I1210
OMA 1 1.010 - - QHG53499
OrthoDB 1 1.010 - - D1522509at2759
OrthoFinder 1 1.000 - - FOG0002579
OrthoInspector 1 1.000 - - oto3703
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1694
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.940

Return to query results.
Submit another query.