DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ube2s

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_598538.1 Gene:Ube2s / 77891 MGIID:1925141 Length:223 Species:Mus musculus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:73/131 - (55%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFH 83
            |.|.|....|  |.:...:|.:   .|.|.:.||:.|||::::::...|:|.||||..|...:||
Mouse    26 DPPDGIKVFP--NEEDLTDLQV---TIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFH 85

  Fly    84 PNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRV 148
            |||.|:|.:|:::|  ::||...:.|:.:||.|:.||..||.:.....||..:..:|..||..|.
Mouse    86 PNVGPNGEICVNVL--KRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARA 148

  Fly   149 R 149
            |
Mouse   149 R 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 46/131 (35%)
Ube2sNP_598538.1 UQ_con 16..152 CDD:306648 46/131 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..223
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53499
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.