DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and UBE2I

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_005255597.1 Gene:UBE2I / 7329 HGNCID:12485 Length:184 Species:Homo sapiens


Alignment Length:137 Identity:120/137 - (87%)
Similarity:132/137 - (96%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            |||||::||.:|||||||||||||||.|.||||||:|||.|||||||||.|||||||:||||:||
Human     1 MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFK 65

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ||||:|||||||||||||||||||||||||:|:|:|||||||||||||||||:|||||||:||||
Human    66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQ 130

  Fly   131 AEAYTIY 137
            |||||||
Human   131 AEAYTIY 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 115/130 (88%)
UBE2IXP_005255597.1 COG5078 1..137 CDD:227410 118/135 (87%)
UQ_con 8..137 CDD:278603 113/128 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 283 1.000 Domainoid score I1648
eggNOG 1 0.900 - - E2759_KOG0424
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5574
Inparanoid 1 1.050 299 1.000 Inparanoid score I2710
Isobase 1 0.950 - 0 Normalized mean entropy S120
OMA 1 1.010 - - QHG53499
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002579
OrthoInspector 1 1.000 - - oto88677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2323
SonicParanoid 1 1.000 - - X1694
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.