DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ube2r2

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001121045.1 Gene:Ube2r2 / 689226 RGDID:1594826 Length:238 Species:Rattus norvegicus


Alignment Length:138 Identity:50/138 - (36%)
Similarity:71/138 - (51%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NLMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEK 101
            :|..||.||.|..:|.:|||.:|..:.|..|||.|||..:|...::|||:|.:|.||:|:|....
  Rat    37 DLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPV 101

  Fly   102 D-----------WRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNR------LEYEKRVR 149
            |           |.|...::.|||.:..||||||...||..:|..::.:.|      .||.:.:|
  Rat   102 DDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIR 166

  Fly   150 AQARAMAA 157
            .|..|..|
  Rat   167 KQVSATKA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 47/131 (36%)
Ube2r2NP_001121045.1 UBCc 11..169 CDD:238117 47/131 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.