DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and ube2i

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001016408.1 Gene:ube2i / 549162 XenbaseID:XB-GENE-974017 Length:158 Species:Xenopus tropicalis


Alignment Length:156 Identity:135/156 - (86%)
Similarity:149/156 - (95%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            |||||::||.:|||||||||||||||.|.||||||:|||.|||||||||.|||||||:||||:||
 Frog     1 MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFK 65

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ||||:|||||||||||||||||||||||||:|:|:|||||||||||||||||:|||||||:||||
 Frog    66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQ 130

  Fly   131 AEAYTIYCQNRLEYEKRVRAQARAMA 156
            |||||||||||:||||||||||:..|
 Frog   131 AEAYTIYCQNRVEYEKRVRAQAKKFA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 127/143 (89%)
ube2iNP_001016408.1 UQ_con 8..152 CDD:395127 127/143 (89%)
Interaction with sumo1. /evidence=ECO:0000250 13..18 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 283 1.000 Domainoid score I1616
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5574
Inparanoid 1 1.050 299 1.000 Inparanoid score I2659
OMA 1 1.010 - - QHG53499
OrthoDB 1 1.010 - - D1522509at2759
OrthoFinder 1 1.000 - - FOG0002579
OrthoInspector 1 1.000 - - oto102546
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2323
SonicParanoid 1 1.000 - - X1694
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.