DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and ube2ka

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka / 541355 ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio


Alignment Length:163 Identity:49/163 - (30%)
Similarity:76/163 - (46%) Gaps:17/163 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNP------DGTLNLMIWECAIPGKKSTPWEGGLYK 59
            |:.||:.|:..|.|...|..      ..:||.      |.....:..|  |.|...||:|||.|:
Zfish     1 MANIAVQRIKREFKEVLKSE------ETSKNQIKVDLVDENFTELRGE--IAGPPDTPYEGGRYQ 57

  Fly    60 LRMIFKDDYPTSPPKCKFEPPLFHPNVYP-SGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEP 123
            |.:...:.||.:|||.:|...::|||:.. :|.:||.:|  :..|..|:|::.:||.:|.||...
Zfish    58 LEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDIL--KGQWAAAMTLRTVLLSLQALLAAA 120

  Fly   124 NIKDPAQAEAYTIYCQNRLEYEKRVRAQARAMA 156
            ...||..|.....|.||...:::..|..:...|
Zfish   121 EPDDPQDAVVANQYKQNPEMFKQTARLWSHVCA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 45/150 (30%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 48/156 (31%)
UBCc 6..148 CDD:238117 45/151 (30%)
UBA_like_SF 163..200 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.