DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ubc7

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:164 Identity:59/164 - (35%)
Similarity:83/164 - (50%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            |:|.|:.||..|.|....|.|.|.||.|....    |...||..|.|.:.|.:|||::..|:||.
  Fly     1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISED----NFFEWEALIAGPEGTCFEGGVFPARLIFP 61

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD-----------WRPAITIKQILLGIQDL 119
            .|||.||||.||...:||||::..|.||:|:|....|           |.|..::::|||.:..:
  Fly    62 TDYPLSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSM 126

  Fly   120 LNEPNIKDPAQAEAYTIYCQNRLEYEKRVRAQAR 153
            |.|||.:..|..:|..::.:.|.|:....|...|
  Fly   127 LAEPNDESGANVDAAIMWREQRDEFNAIARRLVR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 55/154 (36%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 59/164 (36%)
UQ_con 8..159 CDD:278603 55/154 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.