DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and CG5823

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:68/158 - (43%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AITRLGEERKAWRKDHPFGFV-ARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKDDY 68
            |::|:.::....::| |..:: |.|..|     |::.|...:.|.:.:|:.||.|...::|..::
  Fly    15 AVSRMKQDYMRLKRD-PLPYITAEPLPN-----NILEWHYCVKGPEDSPYYGGYYHGTLLFPREF 73

  Fly    69 PTSPPKCKFEPPLFHPNVY---PSG------TVCLSLLDEEKD-WRPAITIKQILLGIQDLLNEP 123
            |..|           |::|   |:|      .:|||:.|...| |.|...:..||.|:...:.| 
  Fly    74 PFKP-----------PSIYMLTPNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLE- 126

  Fly   124 NIKDPAQAEAYTIYCQNRLEYEKRVRAQ 151
                    ...|:.......|:|::.||
  Fly   127 --------STPTLGSIESSNYDKQMFAQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 36/155 (23%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.