DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ubc87F

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster


Alignment Length:153 Identity:52/153 - (33%)
Similarity:78/153 - (50%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HPF-GFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFH 83
            ||. ||.|....:.|    :..||..|.|...|.:|||.:|..:||..:||..|||.||...::|
  Fly    20 HPVEGFSAGLVSDSD----IFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFITEIWH 80

  Fly    84 PNVYPSGTVCLSLLDE-----------EKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 137
            ||:..:|.||:|:|.|           |:.|.|..|::.|||.:..:|.:||.:..|..:|...|
  Fly    81 PNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDAAKEY 145

  Fly   138 CQNRLEYEKRV-RAQARAMAATE 159
            .:|..|::::| |...|:....|
  Fly   146 RENYAEFKRKVTRCVRRSQEEVE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 50/144 (35%)
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 50/146 (34%)
UQ_con 10..160 CDD:278603 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.