DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and ube2nb

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_956636.1 Gene:ube2nb / 393313 ZFINID:ZDB-GENE-040426-1291 Length:154 Species:Danio rerio


Alignment Length:156 Identity:47/156 - (30%)
Similarity:78/156 - (50%) Gaps:8/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            |:|:....:.|.::...:..| |..|.|.:.     |...:...|.|.:.:|:|||.:||.:...
Zfish     1 MAGLPRRIIKETQRLLAEPVP-GIKAEPDEG-----NARYFHVVIAGPQDSPFEGGTFKLELFLP 59

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ::||.:.||.:|...::||||...|.:||.:|.::  |.||:.|:.:||.||.||:.||..||..
Zfish    60 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDK--WSPALQIRTVLLSIQALLSAPNPDDPLA 122

  Fly   131 AEAYTIYCQNRLEYEKRVRAQARAMA 156
            .:....:..|..:..:..|...|..|
Zfish   123 NDVAEQWKSNEAQAIETARTWTRLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 43/143 (30%)
ube2nbNP_956636.1 UBCc 4..151 CDD:412187 45/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.