Sequence 1: | NP_001259833.1 | Gene: | lwr / 33226 | FlyBaseID: | FBgn0010602 | Length: | 159 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287013.1 | Gene: | Ubc4 / 39133 | FlyBaseID: | FBgn0015321 | Length: | 199 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 88/200 - (44%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMI----W---ECAIPGKKSTPWEGGLY 58
Fly 59 KLRMIFKDDYPTSPPKCKFEPPLFHPNVYP-SGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNE 122
Fly 123 PNIKDPAQA-------EAYTIY--------------------CQNRLEYEKRVR------AQARA 154
Fly 155 MAATE 159 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lwr | NP_001259833.1 | UQ_con | 8..152 | CDD:395127 | 42/184 (23%) |
Ubc4 | NP_001287013.1 | COG5078 | 1..153 | CDD:227410 | 41/162 (25%) |
UQ_con | 8..149 | CDD:278603 | 39/151 (26%) | ||
UBA_II_E2_UBCD4 | 163..198 | CDD:270574 | 5/26 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45438052 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |