DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ubc4

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:200 Identity:48/200 - (24%)
Similarity:88/200 - (44%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMI----W---ECAIPGKKSTPWEGGLY 58
            |:.:|::|:..|         |..|.|..:....::.:.:    |   ...|.|...||:|||.:
  Fly     1 MANMAVSRIKRE---------FKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKF 56

  Fly    59 KLRMIFKDDYPTSPPKCKFEPPLFHPNVYP-SGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNE 122
            .|.:...:.||.:|||.:|...::|||:.. :|.:||.:|.:  :|..|:|::.:||.:|.||..
  Fly    57 VLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKD--NWAAAMTLRTVLLSLQALLAA 119

  Fly   123 PNIKDPAQA-------EAYTIY--------------------CQNRLEYEKRVR------AQARA 154
            ....||..|       :.|.::                    |.::::   |:|      .:|||
  Fly   120 AEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQ---RLRDMGIDEHEARA 181

  Fly   155 MAATE 159
            :.:.|
  Fly   182 VLSKE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 42/184 (23%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 41/162 (25%)
UQ_con 8..149 CDD:278603 39/151 (26%)
UBA_II_E2_UBCD4 163..198 CDD:270574 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.