DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Uev1A

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:143 Identity:34/143 - (23%)
Similarity:60/143 - (41%) Gaps:14/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGIAIT---RLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMI 63
            :|:.:.   ||.||....:|....|.::...:| |..:.|..|...|.|...||:|..:|.|::.
  Fly     7 TGVVVPRNFRLLEELDQGQKGVGDGTISWGLEN-DDDMTLTYWIGMIIGPPRTPFENRMYSLKIE 70

  Fly    64 FKDDYPTSPPKCKFEPPLFHPNV----YPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLN-EP 123
            ..:.||..||..:|   :...|:    ..:|.|....:.....|.....||.:|..|:.::. :.
  Fly    71 CGERYPDEPPTLRF---ITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKE 132

  Fly   124 NIK--DPAQAEAY 134
            |:|  .|.:...:
  Fly   133 NLKLAQPPEGSCF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 33/134 (25%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.