DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and CG16894

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:118 Identity:28/118 - (23%)
Similarity:49/118 - (41%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WEGGLYKLRMIFKDDYPT--SPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWR-PAITIKQILL 114
            :.|.:::..::..:::|.  |.|...|...:.||::.|.... |.|.....:|| ....|..:|.
  Fly    57 YAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKT-LDLAHFLNEWRKDEHHIWHVLR 120

  Fly   115 GIQDLLNEPN--------------IKDPAQ-AEAYTIYCQNRLEYEKRVRAQA 152
            .||.:..:|.              |.|..: ..|..:..::|.||.|||:.||
  Fly   121 YIQAIFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKRVQEQA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 26/116 (22%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 28/118 (24%)
UBCc 23..173 CDD:294101 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.