DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and CG8188

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:108 Identity:38/108 - (35%)
Similarity:62/108 - (57%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPA 106
            :..|.|...||:..|::::::....|:|.:|||..|...:|||||..:|.:|::.|  :|||:|.
  Fly    47 QALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTL--KKDWKPD 109

  Fly   107 ITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVR 149
            :.||.|||.|:.||..||.:.....||..:..:...:|.:|.|
  Fly   110 LGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRAR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 38/108 (35%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 38/108 (35%)
UBCc 16..155 CDD:238117 38/108 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.