DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and UbcE2H

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:104 Identity:35/104 - (33%)
Similarity:54/104 - (51%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNV-YPSGTVCLSLLDEEKDWRPAITIK 110
            |...||:|||::|:|:...|:||...|...|...::|||: ..||||||.::::.  |.....:.
  Fly    40 GPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQA--WTALYDLS 102

  Fly   111 QILLG-IQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRV 148
            .|... :..||..||..||...:|..:|.....||.::|
  Fly   103 NIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 35/104 (34%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.