DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ube2l6

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001019926.1 Gene:Ube2l6 / 295704 RGDID:1307960 Length:153 Species:Rattus norvegicus


Alignment Length:112 Identity:32/112 - (28%)
Similarity:60/112 - (53%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NLMIWE-CAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEE 100
            |:::|. ..:|.:  .|:....:.||:.|..:||..||..:|...::|||:...|.|||.|:..|
  Rat    31 NVLVWHMLLLPDQ--LPYRLKAFGLRIDFPREYPLKPPTLRFTTKIYHPNISEDGLVCLPLISTE 93

  Fly   101 KDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKR 147
             :|:|.....|:|..:..|::.||:::|.:.|...:..|:...:.|:
  Rat    94 -NWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLTQDPEMFRKK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 32/112 (29%)
Ube2l6NP_001019926.1 COG5078 1..147 CDD:227410 32/112 (29%)
UQ_con 6..144 CDD:278603 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.