DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Ube2dnl1

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001263325.1 Gene:Ube2dnl1 / 237009 MGIID:3646570 Length:155 Species:Mus musculus


Alignment Length:149 Identity:48/149 - (32%)
Similarity:83/149 - (55%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            :..:|:.|:.:|..|:.:|.|....|.|...     |:..|:..|.|.:.:|::||::.|.:.|.
Mouse     6 LGAMALKRIQKELVAFSQDPPAHCSAGPVAE-----NMFHWQATIMGPEDSPYQGGVFFLSIHFP 65

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ::||..|||..|...::|||:..:|::||.:|:.:  |.|.:||.::||.|..||.:||..||..
Mouse    66 NNYPFKPPKVSFITRIYHPNISKNGSICLDILNSK--WSPTLTISKVLLSICSLLCDPNADDPLV 128

  Fly   131 AEAYTIYCQNRLEYEKRVR 149
            .|...:|.::..||.:..|
Mouse   129 PEIAKVYHKDLREYNRLAR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 47/142 (33%)
Ube2dnl1NP_001263325.1 COG5078 9..155 CDD:227410 48/146 (33%)
UBCc 9..154 CDD:294101 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.