DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and uev-2

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_498198.1 Gene:uev-2 / 186377 WormBaseID:WBGene00006731 Length:230 Species:Caenorhabditis elegans


Alignment Length:147 Identity:52/147 - (35%)
Similarity:82/147 - (55%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPT 70
            |..:.||:..|.:..|.|:.|:|. :.:|......|.|.:||.:.:|||||.|::.:.| ..:|.
 Worm    37 INTVKEEKAKWDERTPQGYTAKPI-SFEGADIWCSWICTVPGPRGSPWEGGEYEVSVNF-HKWPI 99

  Fly    71 SPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYT 135
            .||.|:|:.||.||||...|::.|.:|::| .|....::|::|..|.:||..|::...|..||:.
 Worm   100 IPPICEFKTPLHHPNVDLRGSIYLKMLEQE-HWSSETSLKKLLREISNLLATPDLTQAANIEAWM 163

  Fly   136 IYCQNRLEYEKRVRAQA 152
            .|...|..||.:.||.|
 Worm   164 EYENQRENYEAKARAYA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 50/143 (35%)
uev-2NP_498198.1 UQ_con 40..180 CDD:365926 50/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0424
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522509at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.