DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and Birc6

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_006523581.1 Gene:Birc6 / 12211 MGIID:1276108 Length:4953 Species:Mus musculus


Alignment Length:131 Identity:42/131 - (32%)
Similarity:62/131 - (47%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LMIWECAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPP-----LFHPNVYPSGTVCLSLL 97
            |.|.:..|.|...||:..|.::..:.|..|||:|||....|..     .|:||:|..|.||||:|
Mouse  4702 LDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSIL 4766

  Fly    98 D------EEKDWRP-AITIKQILLGIQDLL-------NEPNIKDPAQAEAYTIYCQNRLEYEKRV 148
            :      ||| |.| ..:..|:|:.:|.|:       |||..:......:.|   |:..||:..:
Mouse  4767 NTWHGRPEEK-WNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGT---QSSREYDGNI 4827

  Fly   149 R 149
            |
Mouse  4828 R 4828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 42/131 (32%)
Birc6XP_006523581.1 BIR 347..420 CDD:237989
BIRC6 3558..3712 CDD:372067
UBCc 4693..4831 CDD:238117 42/131 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.