DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lwr and ube2ia

DIOPT Version :9

Sequence 1:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_571908.1 Gene:ube2ia / 114445 ZFINID:ZDB-GENE-010607-1 Length:157 Species:Danio rerio


Alignment Length:153 Identity:134/153 - (87%)
Similarity:148/153 - (96%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKLRMIFK 65
            |||||::||.:|||||||||||||||.|.||||||:|||.|||||||||.|||||||:||||:||
Zfish     1 MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFK 65

  Fly    66 DDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQ 130
            ||||:|||||||||||||||||||||||||:|:|:|||||||||||||||||:|||||||:||||
Zfish    66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQ 130

  Fly   131 AEAYTIYCQNRLEYEKRVRAQAR 153
            |||||||||||:||||||||||:
Zfish   131 AEAYTIYCQNRVEYEKRVRAQAK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 127/143 (89%)
ube2iaNP_571908.1 UQ_con 8..152 CDD:395127 127/143 (89%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 284 1.000 Domainoid score I1593
eggNOG 1 0.900 - - E2759_KOG0424
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5574
Inparanoid 1 1.050 299 1.000 Inparanoid score I2680
OMA 1 1.010 - - QHG53499
OrthoDB 1 1.010 - - D1522509at2759
OrthoFinder 1 1.000 - - FOG0002579
OrthoInspector 1 1.000 - - otm25521
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2323
SonicParanoid 1 1.000 - - X1694
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.970

Return to query results.
Submit another query.