DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ush and F21A9.2

DIOPT Version :9

Sequence 1:NP_001259829.1 Gene:ush / 33225 FlyBaseID:FBgn0003963 Length:1212 Species:Drosophila melanogaster
Sequence 2:NP_491204.3 Gene:F21A9.2 / 184756 WormBaseID:WBGene00017651 Length:392 Species:Caenorhabditis elegans


Alignment Length:178 Identity:42/178 - (23%)
Similarity:69/178 - (38%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 ASEVDVKSAVSPSIAGAGGLGAGAAEAASSVETTPVAYQQLICAACGIKYTSLDNLRAHQNYYCP 821
            ::.:|:.|  ||.......|.|..:..:.|..:.|:..::.....||:.::|.....||:..||.
 Worm   240 STPLDLSS--SPHAPSVPSLSASCSPTSKSSSSEPIYPERPFSCTCGVSFSSQTTYDAHKQLYCS 302

  Fly   822 KGGAVAAPAATPTDPGQLGMPKEKCGKCKTLHEIGLPCPPPVANPLAAPTVNPQPATNSLNKCPV 886
            ....|::|...|.....|....|||.||..:                 ||.:.|           
 Worm   303 HTTRVSSPGGGPHRNDSLRKVPEKCTKCDFV-----------------PTSSSQ----------- 339

  Fly   887 CGVVSPTAALAKKHMEMHGTVKAYRCSICQYKGNTLRGMRTHIRTHFD 934
                     |:......|.|.|.:.|.:|.|:..::||:|||:|:|.|
 Worm   340 ---------LSMHIRSSHQTTKTFTCLVCGYRAFSMRGIRTHMRSHSD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ushNP_001259829.1 C2H2 Zn finger 884..904 CDD:275370 1/19 (5%)
C2H2 Zn finger 912..932 CDD:275370 9/19 (47%)
zf-H2C2_5 983..1007 CDD:290620
F21A9.2NP_491204.3 C2H2 Zn finger 327..348 CDD:275368 7/57 (12%)
C2H2 Zn finger 356..376 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114804
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.