DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and CRZ1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:415 Identity:94/415 - (22%)
Similarity:148/415 - (35%) Gaps:130/415 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NENLLKAKLKLVAQKSQKNGGIITPNPSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQ 96
            :.|||.|...  :..:..|.|||  |.:||::..  ||:...|....| .|.:|.|.........
Yeast   267 DNNLLSASNN--SDFNNSNNGII--NTADTQNST--IAINKSKVGTNQ-KMLLTIPTSSTPSPST 324

  Fly    97 KAERVSVIMRV------------NSSGAVSSSSQDENSSSSTSCCSSSSN---------TNTSTS 140
            .|..|:.|:.:            ...|.:....:|..|.|:|    :::|         .|.:.|
Yeast   325 HAAPVTPIISIQEFNEGHFPVKNEDDGTLQLKVRDNESYSAT----NNNNLLRPDDNDYNNEALS 385

  Fly   141 SVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEIK--- 202
            .:..:.||...    .|.||.|.:|:|:::.:.....:..:..::.::|...|:.|.....|   
Yeast   386 DIDRSFEDIIN----GRKLKLKKSRRRSSQTSNNSFTSRRSSRSRSISPDEKAKSISANREKLLE 446

  Fly   203 ----------------------------------------PILT--PIYVSPVASSASQL----- 220
                                                    .:||  |...|.:.:..::|     
Yeast   447 MADLLPSSENDNNRERYDNDSKTSYNTINSSNFNEDNNNNNLLTSKPKIESGIVNIKNELDDTSK 511

  Fly   221 ---ILLSTVAAQQ------------------SPTPVPKTPTMSEEKLTTRITAAQAAATRSRIYE 264
               |||...:..|                  ....|.|...:  |||.        :.|.:|...
Yeast   512 DLGILLDIDSLGQFEQKVGFKNDDNHENNDNGTFSVKKNDNL--EKLD--------SVTNNRKNP 566

  Fly   265 CSF--PDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCS- 326
            .:|  ..|||.:.:..:||:|.|.||.||||||  ..|.|.|:|..:..||:..|||:|::.|. 
Yeast   567 ANFACDVCGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLHTGKKRYVCGG 629

  Fly   327 --------VCQKKFMRSDHLSKHVK 343
                    .|.|||.|||.|.:|.|
Yeast   630 KLKDGKPWGCGKKFARSDALGRHFK 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 8/25 (32%)
C2H2 Zn finger 265..287 CDD:275368 8/23 (35%)
COG5048 <270..362 CDD:227381 36/83 (43%)
zf-H2C2_2 279..306 CDD:290200 15/26 (58%)
C2H2 Zn finger 295..317 CDD:275368 7/21 (33%)
zf-H2C2_2 309..332 CDD:290200 9/31 (29%)
zf-C2H2 323..345 CDD:278523 11/30 (37%)
C2H2 Zn finger 325..345 CDD:275368 11/28 (39%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 79/376 (21%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 599..619 CDD:275368 7/21 (33%)
C2H2 Zn finger 627..655 CDD:275368 11/28 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.