DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and AZF1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:88/410 - (21%)
Similarity:154/410 - (37%) Gaps:119/410 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VNSSGAVSSSSQDENSSSSTSCCSSS----------------SNTNTSTSSVPPTVEDDYPEANV 155
            :||:.:.:..:|:::|.:||...|:|                ...|.|::...|..::|..|.:.
Yeast   388 INSATSTNIPNQEDHSLASTDTTSNSRKDLKEIEQRLRKHLNDEDNYSSAISRPLDKNDVIEGSE 452

  Fly   156 WRNLKFK---------MNRKRAAEVALPPVQTPET--PVAKLVTPPAPAECI-----KEEEIKPI 204
            ..|....         ..||:.........:.|.|  |::|..:..|....:     ||..|..|
Yeast   453 GLNKHIDESGMQPNIIKKRKKDDSTVYVKNEMPRTDPPMSKDNSTSAEGAAMANFSGKEPPIPDI 517

  Fly   205 LTPIYVSPVASSASQLI-------LLSTVAAQQS-----------------------PTPVPKTP 239
                  |.|:..|:.||       |:..:.|::.                       |   ||:.
Yeast   518 ------SSVSDDATNLIGATKVDQLMLIIQARKKGFTEKVNTTQDGDLLFNQTMDILP---PKSE 573

  Fly   240 TMS--EEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDK 302
            .:.  |:...|:.|.|      .:.:||  |.|.:.:.:::||:.|.|.|.|.:||:|.:  |.|
Yeast   574 LVGGVEKPKGTQNTRA------VKKHEC--PYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGK 628

  Fly   303 RFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDK---------------ANG 352
            ||::...|..|:|.|||||.:.|.:|.|||.|..:|:.|:..|.|.|               ...
Yeast   629 RFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGN 693

  Fly   353 VNRHVSLANNNTSASVAASLCD------------------ASLHL---RAIAPAGSSASSSPISS 396
            :..|.:..:..|..::.|.|.:                  ||::.   |.|...|....:...:.
Yeast   694 MKAHQNRFHKETLNALTAKLAEMNPSENIPLEERQLLEYFASIYKNSNRGIKGRGKGVGTKKSTI 758

  Fly   397 ASLQVYSAQDLLRLQQQASS 416
            :|.:.:.|..:|.....|::
Yeast   759 SSPENHPASTILNPNTNANN 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 8/23 (35%)
C2H2 Zn finger 265..287 CDD:275368 7/21 (33%)
COG5048 <270..362 CDD:227381 34/106 (32%)
zf-H2C2_2 279..306 CDD:290200 13/26 (50%)
C2H2 Zn finger 295..317 CDD:275368 8/21 (38%)
zf-H2C2_2 309..332 CDD:290200 11/22 (50%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 86/398 (22%)
C2H2 Zn finger 595..615 CDD:275368 7/21 (33%)
C2H2 Zn finger 623..643 CDD:275368 8/21 (38%)
C2H2 Zn finger 651..671 CDD:275368 8/19 (42%)
C2H2 Zn finger 679..702 CDD:275368 1/22 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.