DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cbt and ZSCAN16

DIOPT Version :9

Sequence 1:	NP_722636.1	Gene:	cbt / 33224	FlyBaseID:	FBgn0043364	Length:	428	Species:	Drosophila melanogaster
Sequence 2:	NP_001307484.1	Gene:	ZSCAN16 / 80345	HGNCID:	20813	Length:	348	Species:	Homo sapiens

Alignment Length:	92	Identity:	38/92 - (41%)
Similarity:	53/92 - (57%)	Gaps:	4/92 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   258 TRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKK 322
            |..:.|:|.  :|||.:.:.|||..|.|||||.:|:.||  .|.|.||....|.:|:|.|||||.
Human   259 TGEKPYKCD--ECGKAFIQRSHLIGHHRVHTGVKPYKCK--ECGKDFSGRTGLIQHQRIHTGEKP 319

  Fly   323 FQCSVCQKKFMRSDHLSKHVKRHNKDK 349
            ::|..|.:.|..|..|.:|.:.|..:|
Human   320 YECDECGRPFRVSSALIRHQRIHTANK 346

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cbt	NP_722636.1	zf-C2H2	263..287	CDD:278523	10/23 (43%)
		C2H2 Zn finger	265..287	CDD:275368	9/21 (43%)
		COG5048	<270..362	CDD:227381	35/80 (44%)
		zf-H2C2_2	279..306	CDD:290200	14/26 (54%)
		C2H2 Zn finger	295..317	CDD:275368	9/21 (43%)
		zf-H2C2_2	309..332	CDD:290200	10/22 (45%)
		zf-C2H2	323..345	CDD:278523	6/21 (29%)
		C2H2 Zn finger	325..345	CDD:275368	6/19 (32%)
ZSCAN16	NP_001307484.1	SCAN	37..148	CDD:128708
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	160..184
		COG5048	<183..323	CDD:227381	30/67 (45%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	205..226
		C2H2 Zn finger	238..258	CDD:275368
		C2H2 Zn finger	266..286	CDD:275368	9/21 (43%)
		C2H2 Zn finger	294..314	CDD:275368	9/21 (43%)
		zf-C2H2	320..342	CDD:306579	6/21 (29%)
		C2H2 Zn finger	322..342	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4872
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950