DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and ZNF174

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001334797.1 Gene:ZNF174 / 7727 HGNCID:12963 Length:407 Species:Homo sapiens


Alignment Length:278 Identity:67/278 - (24%)
Similarity:103/278 - (37%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KKPRLEQPAMSMTPPPDQKLDDDQKAERVSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSNTNT 137
            |.|.|::|...:......::..|.|                 .:.|.|.:..:..|..|:..:..
Human   194 KSPLLQEPTPKLAGTEAPRMRSDNK-----------------ENPQQEGAKGAKPCAVSAGRSKG 241

  Fly   138 STSSVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEIK 202
            :....|..           |.......|....:|:.|..|.|.....:        .|    .::
Human   242 NGLQNPEP-----------RGANMSEPRLSRRQVSSPNAQKPFAHYQR--------HC----RVE 283

  Fly   203 PILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRITAAQAAATRS--RIYEC 265
            .|.:|:...|:...                    |.....:..|:.|:.......|||  :.|:|
Human   284 YISSPLKSHPLREL--------------------KKSKGGKRSLSNRLQHLGHQPTRSAKKPYKC 328

  Fly   266 SFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQK 330
            .  ||||::..:|.||.|:||||||||:.|  ..|...|.|...|..|:|.|||||.:||..|.|
Human   329 D--DCGKSFTWNSELKRHKRVHTGERPYTC--GECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGK 389

  Fly   331 KFMRSDHLSKHVKRHNKD 348
            .|.:|.:|.:|.:.|:.|
Human   390 SFRQSSNLHQHHRLHHGD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 11/23 (48%)
C2H2 Zn finger 265..287 CDD:275368 10/21 (48%)
COG5048 <270..362 CDD:227381 37/79 (47%)
zf-H2C2_2 279..306 CDD:290200 14/26 (54%)
C2H2 Zn finger 295..317 CDD:275368 7/21 (33%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
ZNF174NP_001334797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..270 15/103 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4872
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.